PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G0883
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 444aa    MW: 49810.5 Da    PI: 8.0207
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G0883genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.83.9e-11121178147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT...........TTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg...........kgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++             +R  k+c++rw++ 
      Gh_A03G0883 121 RGHWRPAEDTKLKELVALYGPQNWNLIAEKLEgrsgkivaknsGKRKSKSCRLRWFNQ 178
                      899*****************************99999999999889999999999985 PP

2Myb_DNA-binding57.23.7e-18185228146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++ +k++w+ 
      Gh_A03G0883 185 RRAFTEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 228
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.038116171IPR017930Myb domain
SMARTSM007178.7E-11120181IPR001005SANT/Myb domain
PfamPF002491.2E-10121178IPR001005SANT/Myb domain
SuperFamilySSF466892.66E-24121226IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-22122186IPR009057Homeodomain-like
CDDcd001676.23E-10124177No hitNo description
PROSITE profilePS5129427.592180234IPR017930Myb domain
SMARTSM007178.2E-15184232IPR001005SANT/Myb domain
PfamPF002496.0E-15185227IPR001005SANT/Myb domain
CDDcd001675.52E-12187227No hitNo description
Gene3DG3DSA:1.10.10.604.3E-21187233IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MNRLSCHSSA TPSSSSSSMG MVYPDMGCLS LAPNYGIVVS SSRENERASS GFRFMENSKT  60
RSFEENHCSD AVEGKGSDYS DGFGDNNMPI NLNPNLNEEN PNENAVSGKE TDSGQSKLCA  120
RGHWRPAEDT KLKELVALYG PQNWNLIAEK LEGRSGKIVA KNSGKRKSKS CRLRWFNQLD  180
PRINRRAFTE EEEERLMQAH RLYGNKWAMI ARLFPGRTDN AVKNHWHVIM ARKYREQSSA  240
YRRRKLSQSV YRKMEETPNI VCRDAGTKAE PAPYCLNISD RRLGIISHYQ FGIFNGGDAG  300
GVNGGSNVSP HMTSEREAIL SSEAPYRNGF CAQAQPPPFD FFPDLSNDMM GMFSQTRFWD  360
RPIDETQVRG YYPQRQHQQL HPSHMMTMQQ SEFLSSQSNT DSTASITPQV SAIEPSSSVA  420
GSSNYSHYET ILPPFIDFLG VGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-301212337107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.238551e-93boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527270.0KM052727.1 Gossypium hirsutum LOF-like transcription factor LOF3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478703.10.0PREDICTED: myb protein-like isoform X1
TrEMBLA0A089ND600.0A0A089ND60_G
STRINGVIT_01s0026g02600.t011e-171(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.14e-75myb domain protein 105